Anti NECAB3 pAb (ATL-HPA071786)

Atlas Antibodies

SKU: ATL-HPA071786-25

• 
• 

Protein Description: N-terminal EF-hand calcium binding protein 3
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027489: 90%, ENSRNOG00000016708: 88%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER
• Gene Sequence: DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER
• Gene ID - Mouse: ENSMUSG00000027489
• Gene ID - Rat: ENSRNOG00000016708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.