Anti NDUFV1 pAb (ATL-HPA045211)

Atlas Antibodies

SKU:
ATL-HPA045211-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 96%, ENSRNOG00000018117: 94%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYD
Gene Sequence HDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYD
Gene ID - Mouse ENSMUSG00000037916
Gene ID - Rat ENSRNOG00000018117
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NDUFV1 pAb (ATL-HPA045211)
Datasheet Anti NDUFV1 pAb (ATL-HPA045211) Datasheet (External Link)
Vendor Page Anti NDUFV1 pAb (ATL-HPA045211) at Atlas Antibodies

Documents & Links for Anti NDUFV1 pAb (ATL-HPA045211)
Datasheet Anti NDUFV1 pAb (ATL-HPA045211) Datasheet (External Link)
Vendor Page Anti NDUFV1 pAb (ATL-HPA045211)