Anti NDUFS2 pAb (ATL-HPA055140 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055140-25
  • Immunohistochemistry analysis in human heart muscle and pancreas tissues using HPA055140 antibody. Corresponding NDUFS2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
  • Western blot analysis using Anti-NDUFS2 antibody HPA055140 (A) shows similar pattern to independent antibody HPA061953 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS2
Alternative Gene Name: CI-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013593: 100%, ENSRNOG00000038372: 100%
Entrez Gene ID: 4720
Uniprot ID: O75306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLD
Gene Sequence KVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLD
Gene ID - Mouse ENSMUSG00000013593
Gene ID - Rat ENSRNOG00000038372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti NDUFS2 pAb (ATL-HPA055140 w/enhanced validation)
Datasheet Anti NDUFS2 pAb (ATL-HPA055140 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFS2 pAb (ATL-HPA055140 w/enhanced validation)