Anti NDUFB8 pAb (ATL-HPA065549)

Atlas Antibodies

SKU: ATL-HPA065549-25

• 

Product Description

Protein Description: NADH:ubiquinone oxidoreductase subunit B8
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 86%, ENSRNOG00000014078: 92%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
• Gene Sequence: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
• Gene ID - Mouse: ENSMUSG00000025204
• Gene ID - Rat: ENSRNOG00000014078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links