![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/99646/179273/atl-hpa065549_anti-ndufb8-pab-atl-hpa065549_60935__73405.1681134931.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99646/179273/atl-hpa065549_anti-ndufb8-pab-atl-hpa065549_60935__73405.1681134931.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: NADH:ubiquinone oxidoreductase subunit B8
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 86%, ENSRNOG00000014078: 92%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 86%, ENSRNOG00000014078: 92%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI |
| Documents & Links for Anti NDUFB8 pAb (ATL-HPA065549) | |
| Datasheet | Anti NDUFB8 pAb (ATL-HPA065549) Datasheet (External Link) |
| Vendor Page | Anti NDUFB8 pAb (ATL-HPA065549) at Atlas |
| Documents & Links for Anti NDUFB8 pAb (ATL-HPA065549) | |
| Datasheet | Anti NDUFB8 pAb (ATL-HPA065549) Datasheet (External Link) |
| Vendor Page | Anti NDUFB8 pAb (ATL-HPA065549) |