Anti NDUFB8 pAb (ATL-HPA065549)
Atlas Antibodies
- SKU:
- ATL-HPA065549-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: NADH:ubiquinone oxidoreductase subunit B8
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 86%, ENSRNOG00000014078: 92%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 86%, ENSRNOG00000014078: 92%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI |
Gene Sequence | YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI |
Gene ID - Mouse | ENSMUSG00000025204 |
Gene ID - Rat | ENSRNOG00000014078 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NDUFB8 pAb (ATL-HPA065549) | |
Datasheet | Anti NDUFB8 pAb (ATL-HPA065549) Datasheet (External Link) |
Vendor Page | Anti NDUFB8 pAb (ATL-HPA065549) at Atlas Antibodies |
Documents & Links for Anti NDUFB8 pAb (ATL-HPA065549) | |
Datasheet | Anti NDUFB8 pAb (ATL-HPA065549) Datasheet (External Link) |
Vendor Page | Anti NDUFB8 pAb (ATL-HPA065549) |