Anti NDUFB4 pAb (ATL-HPA051739 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051739-25
  • Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-NDUFB4 antibody. Corresponding NDUFB4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000032733: 72%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
Gene Sequence MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
Gene ID - Mouse ENSMUSG00000022820
Gene ID - Rat ENSRNOG00000032733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti NDUFB4 pAb (ATL-HPA051739 w/enhanced validation)
Datasheet Anti NDUFB4 pAb (ATL-HPA051739 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFB4 pAb (ATL-HPA051739 w/enhanced validation)