Anti NDUFB2 pAb (ATL-HPA051377)

Atlas Antibodies

SKU: ATL-HPA051377-25

• 

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa
Gene Name: NDUFB2
Alternative Gene Name: AGGG, CI-AGGG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002416: 87%, ENSRNOG00000026616: 79%
Entrez Gene ID: 4708
Uniprot ID: O95178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
• Gene Sequence: QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
• Gene ID - Mouse: ENSMUSG00000002416
• Gene ID - Rat: ENSRNOG00000026616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.