Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
Gene Name: NDUFB1
Alternative Gene Name: CI-MNLL, MNLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050668: 36%, ENSRNOG00000025317: 39%
Entrez Gene ID: 4707
Uniprot ID: O75438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFB1
Alternative Gene Name: CI-MNLL, MNLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050668: 36%, ENSRNOG00000025317: 39%
Entrez Gene ID: 4707
Uniprot ID: O75438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK |
| Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737) | |
| Datasheet | Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link) |
| Vendor Page | Anti NDUFB1 pAb (ATL-HPA063737) at Atlas |
| Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737) | |
| Datasheet | Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link) |
| Vendor Page | Anti NDUFB1 pAb (ATL-HPA063737) |