Anti NDUFAF4 pAb (ATL-HPA046560)

Atlas Antibodies

SKU:
ATL-HPA046560-25
  • Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 4
Gene Name: NDUFAF4
Alternative Gene Name: bA22L21.1, C6orf66, HRPAP20, HSPC125, My013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028261: 83%, ENSRNOG00000007506: 83%
Entrez Gene ID: 29078
Uniprot ID: Q9P032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Gene Sequence IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Gene ID - Mouse ENSMUSG00000028261
Gene ID - Rat ENSRNOG00000007506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NDUFAF4 pAb (ATL-HPA046560)
Datasheet Anti NDUFAF4 pAb (ATL-HPA046560) Datasheet (External Link)
Vendor Page Anti NDUFAF4 pAb (ATL-HPA046560) at Atlas Antibodies

Documents & Links for Anti NDUFAF4 pAb (ATL-HPA046560)
Datasheet Anti NDUFAF4 pAb (ATL-HPA046560) Datasheet (External Link)
Vendor Page Anti NDUFAF4 pAb (ATL-HPA046560)