Anti NDUFA3 pAb (ATL-HPA046976)

Atlas Antibodies

SKU: ATL-HPA046976-25

• 

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
Gene Name: NDUFA3
Alternative Gene Name: B9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035674: 88%, ENSRNOG00000060293: 83%
Entrez Gene ID: 4696
Uniprot ID: O95167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
• Gene Sequence: PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
• Gene ID - Mouse: ENSMUSG00000035674
• Gene ID - Rat: ENSRNOG00000060293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.