Protein Description: NADH:ubiquinone oxidoreductase subunit A10
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT |
| Documents & Links for Anti NDUFA10 pAb (ATL-HPA067045) | |
| Datasheet | Anti NDUFA10 pAb (ATL-HPA067045) Datasheet (External Link) |
| Vendor Page | Anti NDUFA10 pAb (ATL-HPA067045) at Atlas |
| Documents & Links for Anti NDUFA10 pAb (ATL-HPA067045) | |
| Datasheet | Anti NDUFA10 pAb (ATL-HPA067045) Datasheet (External Link) |
| Vendor Page | Anti NDUFA10 pAb (ATL-HPA067045) |