Anti NDUFA1 pAb (ATL-HPA054359 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054359-25

• 

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Gene Name: NDUFA1
Alternative Gene Name: CI-MWFE, MWFE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016427: 82%, ENSRNOG00000052226: 82%
Entrez Gene ID: 4694
Uniprot ID: O15239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
• Gene Sequence: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
• Gene ID - Mouse: ENSMUSG00000016427
• Gene ID - Rat: ENSRNOG00000052226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.