Protein Description: necdin, melanoma antigen (MAGE) family member
Gene Name: NDN
Alternative Gene Name: HsT16328, PWCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033585: 88%, ENSRNOG00000010146: 88%
Entrez Gene ID: 4692
Uniprot ID: Q99608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDN
Alternative Gene Name: HsT16328, PWCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033585: 88%, ENSRNOG00000010146: 88%
Entrez Gene ID: 4692
Uniprot ID: Q99608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI |
| Documents & Links for Anti NDN pAb (ATL-HPA074457) | |
| Datasheet | Anti NDN pAb (ATL-HPA074457) Datasheet (External Link) |
| Vendor Page | Anti NDN pAb (ATL-HPA074457) at Atlas |
| Documents & Links for Anti NDN pAb (ATL-HPA074457) | |
| Datasheet | Anti NDN pAb (ATL-HPA074457) Datasheet (External Link) |
| Vendor Page | Anti NDN pAb (ATL-HPA074457) |