Anti NCSTN pAb (ATL-HPA070642)

Atlas Antibodies

SKU: ATL-HPA070642-25

• 

Product Description

Protein Description: nicastrin
Gene Name: NCSTN
Alternative Gene Name: APH2, KIAA0253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003458: 91%, ENSRNOG00000005355: 93%
Entrez Gene ID: 23385
Uniprot ID: Q92542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV
• Gene Sequence: VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV
• Gene ID - Mouse: ENSMUSG00000003458
• Gene ID - Rat: ENSRNOG00000005355
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links