Anti NCOR1 pAb (ATL-HPA051168)

Atlas Antibodies

SKU:
ATL-HPA051168-25
  • Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear receptor corepressor 1
Gene Name: NCOR1
Alternative Gene Name: hCIT529I10, hN-CoR, KIAA1047, MGC104216, N-CoR, PPP1R109, TRAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018501: 85%, ENSRNOG00000055246: 84%
Entrez Gene ID: 9611
Uniprot ID: O75376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ
Gene Sequence PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ
Gene ID - Mouse ENSMUSG00000018501
Gene ID - Rat ENSRNOG00000055246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NCOR1 pAb (ATL-HPA051168)
Datasheet Anti NCOR1 pAb (ATL-HPA051168) Datasheet (External Link)
Vendor Page Anti NCOR1 pAb (ATL-HPA051168) at Atlas Antibodies

Documents & Links for Anti NCOR1 pAb (ATL-HPA051168)
Datasheet Anti NCOR1 pAb (ATL-HPA051168) Datasheet (External Link)
Vendor Page Anti NCOR1 pAb (ATL-HPA051168)