Anti NCOA5 pAb (ATL-HPA050231)

Atlas Antibodies

SKU:
ATL-HPA050231-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & actin filaments.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear receptor coactivator 5
Gene Name: NCOA5
Alternative Gene Name: bA465L10.6, CIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039804: 92%, ENSRNOG00000017824: 92%
Entrez Gene ID: 57727
Uniprot ID: Q9HCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Gene Sequence NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Gene ID - Mouse ENSMUSG00000039804
Gene ID - Rat ENSRNOG00000017824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NCOA5 pAb (ATL-HPA050231)
Datasheet Anti NCOA5 pAb (ATL-HPA050231) Datasheet (External Link)
Vendor Page Anti NCOA5 pAb (ATL-HPA050231) at Atlas Antibodies

Documents & Links for Anti NCOA5 pAb (ATL-HPA050231)
Datasheet Anti NCOA5 pAb (ATL-HPA050231) Datasheet (External Link)
Vendor Page Anti NCOA5 pAb (ATL-HPA050231)