Anti NCOA4 pAb (ATL-HPA065208)

Atlas Antibodies

SKU: ATL-HPA065208-25

• 

Protein Description: nuclear receptor coactivator 4
Gene Name: NCOA4
Alternative Gene Name: ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021908: 86%, ENSRNOG00000019768: 86%
Entrez Gene ID: 8031
Uniprot ID: Q13772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
• Gene Sequence: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
• Gene ID - Mouse: ENSMUSG00000021908
• Gene ID - Rat: ENSRNOG00000019768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCOA4 pAb (ATL-HPA065208) – 1 Found

Mou, Yanhua; Wu, Jinchun; Zhang, Yao; Abdihamid, Omar; Duan, Chaojun; Li, Bin. Low expression of ferritinophagy-related NCOA4 gene in relation to unfavorable outcome and defective immune cells infiltration in clear cell renal carcinoma. Bmc Cancer. 2021;21(1):18.