Protein Description: nuclear receptor coactivator 4
Gene Name: NCOA4
Alternative Gene Name: ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021908: 86%, ENSRNOG00000019768: 86%
Entrez Gene ID: 8031
Uniprot ID: Q13772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NCOA4
Alternative Gene Name: ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021908: 86%, ENSRNOG00000019768: 86%
Entrez Gene ID: 8031
Uniprot ID: Q13772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ |
| Documents & Links for Anti NCOA4 pAb (ATL-HPA065208) | |
| Datasheet | Anti NCOA4 pAb (ATL-HPA065208) Datasheet (External Link) |
| Vendor Page | Anti NCOA4 pAb (ATL-HPA065208) at Atlas |
| Documents & Links for Anti NCOA4 pAb (ATL-HPA065208) | |
| Datasheet | Anti NCOA4 pAb (ATL-HPA065208) Datasheet (External Link) |
| Vendor Page | Anti NCOA4 pAb (ATL-HPA065208) |
| Citations for Anti NCOA4 pAb (ATL-HPA065208) – 1 Found |
| Mou, Yanhua; Wu, Jinchun; Zhang, Yao; Abdihamid, Omar; Duan, Chaojun; Li, Bin. Low expression of ferritinophagy-related NCOA4 gene in relation to unfavorable outcome and defective immune cells infiltration in clear cell renal carcinoma. Bmc Cancer. 2021;21(1):18. PubMed |