Anti NCKIPSD pAb (ATL-HPA050005)

Atlas Antibodies

SKU: ATL-HPA050005-100

• 
• 

Protein Description: NCK interacting protein with SH3 domain
Gene Name: NCKIPSD
Alternative Gene Name: AF3P21, DIP1, ORF1, SPIN90, WASLBP, WISH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107055: 72%, ENSRNOG00000031816: 69%
Entrez Gene ID: 51517
Uniprot ID: Q9NZQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
• Gene Sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
• Gene ID - Mouse: ENSMUSG00000107055
• Gene ID - Rat: ENSRNOG00000031816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.