Anti NCF1 pAb (ATL-HPA047836 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047836-25

• 

Protein Description: neutrophil cytosolic factor 1
Gene Name: NCF1
Alternative Gene Name: NCF1A, NOXO2, p47phox, SH3PXD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015950: 86%, ENSRNOG00000001480: 85%
Entrez Gene ID: 653361
Uniprot ID: P14598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
• Gene Sequence: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
• Gene ID - Mouse: ENSMUSG00000015950
• Gene ID - Rat: ENSRNOG00000001480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.