Anti NBEAL1 pAb (ATL-HPA049447)

Atlas Antibodies

SKU:
ATL-HPA049447-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neurobeachin-like 1
Gene Name: NBEAL1
Alternative Gene Name: ALS2CR16, ALS2CR17, MGC164581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073664: 82%, ENSRNOG00000021525: 80%
Entrez Gene ID: 65065
Uniprot ID: Q6ZS30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFSINGKYLGSQILKEQVSDICIIGEHIVTGSIQGFLSIRDLHSLNLSINPLAMRLPIHCVCVTKEYS
Gene Sequence TIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFSINGKYLGSQILKEQVSDICIIGEHIVTGSIQGFLSIRDLHSLNLSINPLAMRLPIHCVCVTKEYS
Gene ID - Mouse ENSMUSG00000073664
Gene ID - Rat ENSRNOG00000021525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NBEAL1 pAb (ATL-HPA049447)
Datasheet Anti NBEAL1 pAb (ATL-HPA049447) Datasheet (External Link)
Vendor Page Anti NBEAL1 pAb (ATL-HPA049447) at Atlas Antibodies

Documents & Links for Anti NBEAL1 pAb (ATL-HPA049447)
Datasheet Anti NBEAL1 pAb (ATL-HPA049447) Datasheet (External Link)
Vendor Page Anti NBEAL1 pAb (ATL-HPA049447)