Anti NBEAL1 pAb (ATL-HPA049189)
Atlas Antibodies
- SKU:
- ATL-HPA049189-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NBEAL1
Alternative Gene Name: ALS2CR16, ALS2CR17, MGC164581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073664: 91%, ENSRNOG00000021525: 91%
Entrez Gene ID: 65065
Uniprot ID: Q6ZS30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE |
Gene Sequence | QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE |
Gene ID - Mouse | ENSMUSG00000073664 |
Gene ID - Rat | ENSRNOG00000021525 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189) | |
Datasheet | Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link) |
Vendor Page | Anti NBEAL1 pAb (ATL-HPA049189) at Atlas Antibodies |
Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189) | |
Datasheet | Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link) |
Vendor Page | Anti NBEAL1 pAb (ATL-HPA049189) |