Anti NBEAL1 pAb (ATL-HPA049189)

Atlas Antibodies

SKU:
ATL-HPA049189-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neurobeachin-like 1
Gene Name: NBEAL1
Alternative Gene Name: ALS2CR16, ALS2CR17, MGC164581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073664: 91%, ENSRNOG00000021525: 91%
Entrez Gene ID: 65065
Uniprot ID: Q6ZS30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
Gene Sequence QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
Gene ID - Mouse ENSMUSG00000073664
Gene ID - Rat ENSRNOG00000021525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189)
Datasheet Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link)
Vendor Page Anti NBEAL1 pAb (ATL-HPA049189) at Atlas Antibodies

Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189)
Datasheet Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link)
Vendor Page Anti NBEAL1 pAb (ATL-HPA049189)