Anti NAXE pAb (ATL-HPA048164 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048164-25

• 
• 
• 

Protein Description: NAD(P)HX epimerase
Gene Name: NAXE
Alternative Gene Name: AIBP, APOA1BP, MGC119143, MGC119144, MGC119145, YJEFN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028070: 94%, ENSRNOG00000019201: 96%
Entrez Gene ID: 128240
Uniprot ID: Q8NCW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL
• Gene Sequence: DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL
• Gene ID - Mouse: ENSMUSG00000028070
• Gene ID - Rat: ENSRNOG00000019201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NAXE pAb (ATL-HPA048164 w/enhanced validation) – 1 Found

Kremer, Laura S; Danhauser, Katharina; Herebian, Diran; Petkovic Ramadža, Danijela; Piekutowska-Abramczuk, Dorota; Seibt, Annette; Müller-Felber, Wolfgang; Haack, Tobias B; Płoski, Rafał; Lohmeier, Klaus; Schneider, Dominik; Klee, Dirk; Rokicki, Dariusz; Mayatepek, Ertan; Strom, Tim M; Meitinger, Thomas; Klopstock, Thomas; Pronicka, Ewa; Mayr, Johannes A; Baric, Ivo; Distelmaier, Felix; Prokisch, Holger. NAXE Mutations Disrupt the Cellular NAD(P)HX Repair System and Cause a Lethal Neurometabolic Disorder of Early Childhood. American Journal Of Human Genetics. 2016;99(4):894-902.