Anti NARF pAb (ATL-HPA053006)

Atlas Antibodies

SKU:
ATL-HPA053006-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear prelamin A recognition factor
Gene Name: NARF
Alternative Gene Name: DKFZp434G0420, FLJ10067, IOP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000056: 84%, ENSRNOG00000036664: 93%
Entrez Gene ID: 26502
Uniprot ID: Q9UHQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG
Gene Sequence KTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG
Gene ID - Mouse ENSMUSG00000000056
Gene ID - Rat ENSRNOG00000036664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NARF pAb (ATL-HPA053006)
Datasheet Anti NARF pAb (ATL-HPA053006) Datasheet (External Link)
Vendor Page Anti NARF pAb (ATL-HPA053006) at Atlas Antibodies

Documents & Links for Anti NARF pAb (ATL-HPA053006)
Datasheet Anti NARF pAb (ATL-HPA053006) Datasheet (External Link)
Vendor Page Anti NARF pAb (ATL-HPA053006)