Anti NAPSA pAb (ATL-HPA047744 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047744-100

• 
• 

Protein Description: napsin A aspartic peptidase
Gene Name: NAPSA
Alternative Gene Name: KAP, Kdap, NAP1, NAPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002204: 80%, ENSRNOG00000019854: 82%
Entrez Gene ID: 9476
Uniprot ID: O96009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVF
• Gene Sequence: GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVF
• Gene ID - Mouse: ENSMUSG00000002204
• Gene ID - Rat: ENSRNOG00000019854
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.