Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047236-100
  • Immunohistochemistry analysis in human lung and placenta tissues using Anti-NAPSA antibody. Corresponding NAPSA RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Lung tissue
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: napsin A aspartic peptidase
Gene Name: NAPSA
Alternative Gene Name: KAP, Kdap, NAP1, NAPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002204: 81%, ENSRNOG00000019854: 81%
Entrez Gene ID: 9476
Uniprot ID: O96009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF
Gene Sequence DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF
Gene ID - Mouse ENSMUSG00000002204
Gene ID - Rat ENSRNOG00000019854
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation)
Datasheet Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation)
Datasheet Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NAPSA pAb (ATL-HPA047236 w/enhanced validation)