Anti NANP pAb (ATL-HPA050342 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050342-25

• 
• 
• 

Protein Description: N-acetylneuraminic acid phosphatase
Gene Name: NANP
Alternative Gene Name: C20orf147, dJ694B14.3, HDHD4, MGC26833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043346: 93%, ENSRNOG00000008307: 95%
Entrez Gene ID: 140838
Uniprot ID: Q8TBE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD
• Gene Sequence: NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD
• Gene ID - Mouse: ENSMUSG00000043346
• Gene ID - Rat: ENSRNOG00000008307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.