Anti NAGPA pAb (ATL-HPA064055)
Atlas Antibodies
- SKU:
- ATL-HPA064055-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Gene Name: NAGPA
Alternative Gene Name: APAA, UCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023143: 89%, ENSRNOG00000002895: 92%
Entrez Gene ID: 51172
Uniprot ID: Q9UK23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAGPA
Alternative Gene Name: APAA, UCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023143: 89%, ENSRNOG00000002895: 92%
Entrez Gene ID: 51172
Uniprot ID: Q9UK23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAE |
Gene Sequence | FFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAE |
Gene ID - Mouse | ENSMUSG00000023143 |
Gene ID - Rat | ENSRNOG00000002895 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NAGPA pAb (ATL-HPA064055) | |
Datasheet | Anti NAGPA pAb (ATL-HPA064055) Datasheet (External Link) |
Vendor Page | Anti NAGPA pAb (ATL-HPA064055) at Atlas Antibodies |
Documents & Links for Anti NAGPA pAb (ATL-HPA064055) | |
Datasheet | Anti NAGPA pAb (ATL-HPA064055) Datasheet (External Link) |
Vendor Page | Anti NAGPA pAb (ATL-HPA064055) |