Protein Description: nascent polypeptide-associated complex alpha subunit
Gene Name: NACA
Alternative Gene Name: NACA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061315: 100%, ENSRNOG00000002632: 100%
Entrez Gene ID: 4666
Uniprot ID: Q13765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NACA
Alternative Gene Name: NACA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061315: 100%, ENSRNOG00000002632: 100%
Entrez Gene ID: 4666
Uniprot ID: Q13765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV |
| Documents & Links for Anti NACA pAb (ATL-HPA073648) | |
| Datasheet | Anti NACA pAb (ATL-HPA073648) Datasheet (External Link) |
| Vendor Page | Anti NACA pAb (ATL-HPA073648) at Atlas |
| Documents & Links for Anti NACA pAb (ATL-HPA073648) | |
| Datasheet | Anti NACA pAb (ATL-HPA073648) Datasheet (External Link) |
| Vendor Page | Anti NACA pAb (ATL-HPA073648) |