Anti NABP2 pAb (ATL-HPA057213)

Atlas Antibodies

SKU: ATL-HPA057213-25

• 

Protein Description: nucleic acid binding protein 2
Gene Name: NABP2
Alternative Gene Name: hSSB1, MGC2731, OBFC2B, SOSS-B1, SSB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025374: 74%, ENSRNOG00000023480: 76%
Entrez Gene ID: 79035
Uniprot ID: Q9BQ15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS
• Gene Sequence: FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS
• Gene ID - Mouse: ENSMUSG00000025374
• Gene ID - Rat: ENSRNOG00000023480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.