Anti NABP1 pAb (ATL-HPA054978)

Atlas Antibodies

SKU:
ATL-HPA054978-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleic acid binding protein 1
Gene Name: NABP1
Alternative Gene Name: DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, OBFC2A, SOSS-B2, SSB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026107: 67%, ENSRNOG00000015416: 66%
Entrez Gene ID: 64859
Uniprot ID: Q96AH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Gene Sequence EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Gene ID - Mouse ENSMUSG00000026107
Gene ID - Rat ENSRNOG00000015416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NABP1 pAb (ATL-HPA054978)
Datasheet Anti NABP1 pAb (ATL-HPA054978) Datasheet (External Link)
Vendor Page Anti NABP1 pAb (ATL-HPA054978) at Atlas Antibodies

Documents & Links for Anti NABP1 pAb (ATL-HPA054978)
Datasheet Anti NABP1 pAb (ATL-HPA054978) Datasheet (External Link)
Vendor Page Anti NABP1 pAb (ATL-HPA054978)