Anti NAALADL1 pAb (ATL-HPA047123 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047123-25

• 

Protein Description: N-acetylated alpha-linked acidic dipeptidase-like 1
Gene Name: NAALADL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054999: 75%, ENSRNOG00000021000: 82%
Entrez Gene ID: 10004
Uniprot ID: Q9UQQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSDSFFLPLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVTAVEKFEAEAAALGQRISTLQKGSPDPLQVRMLN
• Gene Sequence: RLSDSFFLPLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVTAVEKFEAEAAALGQRISTLQKGSPDPLQVRMLN
• Gene ID - Mouse: ENSMUSG00000054999
• Gene ID - Rat: ENSRNOG00000021000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.