Anti NAA40 pAb (ATL-HPA056142)

Atlas Antibodies

SKU:
ATL-HPA056142-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: N(alpha)-acetyltransferase 40, NatD catalytic subunit
Gene Name: NAA40
Alternative Gene Name: FLJ13848, NAT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024764: 100%, ENSRNOG00000021179: 100%
Entrez Gene ID: 79829
Uniprot ID: Q86UY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFD
Gene Sequence KSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFD
Gene ID - Mouse ENSMUSG00000024764
Gene ID - Rat ENSRNOG00000021179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NAA40 pAb (ATL-HPA056142)
Datasheet Anti NAA40 pAb (ATL-HPA056142) Datasheet (External Link)
Vendor Page Anti NAA40 pAb (ATL-HPA056142) at Atlas Antibodies

Documents & Links for Anti NAA40 pAb (ATL-HPA056142)
Datasheet Anti NAA40 pAb (ATL-HPA056142) Datasheet (External Link)
Vendor Page Anti NAA40 pAb (ATL-HPA056142)