Anti NAA35 pAb (ATL-HPA051586)

Atlas Antibodies

SKU: ATL-HPA051586-100

• 
• 

Protein Description: N(alpha)-acetyltransferase 35, NatC auxiliary subunit
Gene Name: NAA35
Alternative Gene Name: bA379P1.1, FLJ21613, FLJ22643, MAK10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021555: 92%, ENSRNOG00000018417: 92%
Entrez Gene ID: 60560
Uniprot ID: Q5VZE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL
• Gene Sequence: DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL
• Gene ID - Mouse: ENSMUSG00000021555
• Gene ID - Rat: ENSRNOG00000018417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.