Anti MZB1 pAb (ATL-HPA052694 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052694-100

• 
• 

Protein Description: marginal zone B and B1 cell-specific protein
Gene Name: MZB1
Alternative Gene Name: HSPC190, MEDA-7, MGC29506, PACAP, pERp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 72%, ENSRNOG00000022009: 73%
Entrez Gene ID: 51237
Uniprot ID: Q8WU39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
• Gene Sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
• Gene ID - Mouse: ENSMUSG00000024353
• Gene ID - Rat: ENSRNOG00000022009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.