Protein Description: myosin IIIA
Gene Name: MYO3A
Alternative Gene Name: DFNB30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025716: 61%, ENSRNOG00000018478: 62%
Entrez Gene ID: 53904
Uniprot ID: Q8NEV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYO3A
Alternative Gene Name: DFNB30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025716: 61%, ENSRNOG00000018478: 62%
Entrez Gene ID: 53904
Uniprot ID: Q8NEV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KRRPRKDSQGKLLDLEDFYYKEFLPSRSGPKEHSPSLRERRPQQELQNQCIKANERCWAAESPEKEEEREPAANPYDFR |
| Documents & Links for Anti MYO3A pAb (ATL-HPA075413) | |
| Datasheet | Anti MYO3A pAb (ATL-HPA075413) Datasheet (External Link) |
| Vendor Page | Anti MYO3A pAb (ATL-HPA075413) at Atlas |
| Documents & Links for Anti MYO3A pAb (ATL-HPA075413) | |
| Datasheet | Anti MYO3A pAb (ATL-HPA075413) Datasheet (External Link) |
| Vendor Page | Anti MYO3A pAb (ATL-HPA075413) |