Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055242-25
  • Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-MYO1F antibody. Corresponding MYO1F RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myosin IF
Gene Name: MYO1F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024300: 73%, ENSRNOG00000008409: 72%
Entrez Gene ID: 4542
Uniprot ID: O00160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
Gene Sequence RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
Gene ID - Mouse ENSMUSG00000024300
Gene ID - Rat ENSRNOG00000008409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation)
Datasheet Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation)
Datasheet Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation)



Citations for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) – 1 Found
Piedra-Quintero, Zayda L; Serrano, Carolina; Villegas-Sepúlveda, Nicolás; Maravillas-Montero, José L; Romero-Ramírez, Sandra; Shibayama, Mineko; Medina-Contreras, Oscar; Nava, Porfirio; Santos-Argumedo, Leopoldo. Myosin 1F Regulates M1-Polarization by Stimulating Intercellular Adhesion in Macrophages. Frontiers In Immunology. 9( 30687322):3118.  PubMed