Anti MYO1B pAb (ATL-HPA060144)
Atlas Antibodies
- SKU:
- ATL-HPA060144-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: myosin IB
Gene Name: MYO1B
Alternative Gene Name: myr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018417: 100%, ENSRNOG00000048152: 100%
Entrez Gene ID: 4430
Uniprot ID: O43795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYO1B
Alternative Gene Name: myr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018417: 100%, ENSRNOG00000048152: 100%
Entrez Gene ID: 4430
Uniprot ID: O43795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR |
Gene Sequence | EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR |
Gene ID - Mouse | ENSMUSG00000018417 |
Gene ID - Rat | ENSRNOG00000048152 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYO1B pAb (ATL-HPA060144) | |
Datasheet | Anti MYO1B pAb (ATL-HPA060144) Datasheet (External Link) |
Vendor Page | Anti MYO1B pAb (ATL-HPA060144) at Atlas Antibodies |
Documents & Links for Anti MYO1B pAb (ATL-HPA060144) | |
Datasheet | Anti MYO1B pAb (ATL-HPA060144) Datasheet (External Link) |
Vendor Page | Anti MYO1B pAb (ATL-HPA060144) |