Anti MYO19 pAb (ATL-HPA059715)

Atlas Antibodies

SKU:
ATL-HPA059715-25
  • Immunohistochemical staining of human skin shows moderate positivity in epidermal cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myosin XIX
Gene Name: MYO19
Alternative Gene Name: FLJ22865, MYOHD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020527: 94%, ENSRNOG00000002852: 91%
Entrez Gene ID: 80179
Uniprot ID: Q96H55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL
Gene Sequence FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL
Gene ID - Mouse ENSMUSG00000020527
Gene ID - Rat ENSRNOG00000002852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYO19 pAb (ATL-HPA059715)
Datasheet Anti MYO19 pAb (ATL-HPA059715) Datasheet (External Link)
Vendor Page Anti MYO19 pAb (ATL-HPA059715) at Atlas Antibodies

Documents & Links for Anti MYO19 pAb (ATL-HPA059715)
Datasheet Anti MYO19 pAb (ATL-HPA059715) Datasheet (External Link)
Vendor Page Anti MYO19 pAb (ATL-HPA059715)



Citations for Anti MYO19 pAb (ATL-HPA059715) – 1 Found
Shi, Peng; Ren, Xiaoyu; Meng, Jie; Kang, Chenlu; Wu, Yihe; Rong, Yingxue; Zhao, Shujuan; Jiang, Zhaodi; Liang, Ling; He, Wanzhong; Yin, Yuxin; Li, Xiangdong; Liu, Yong; Huang, Xiaoshuai; Sun, Yujie; Li, Bo; Wu, Congying. Mechanical instability generated by Myosin 19 contributes to mitochondria cristae architecture and OXPHOS. Nature Communications. 2022;13(1):2673.  PubMed