Anti MYMX pAb (ATL-HPA051451)

Atlas Antibodies

SKU:
ATL-HPA051451-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myomixer, myoblast fusion factor
Gene Name: MYMX
Alternative Gene Name: MINION
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079471: 79%, ENSRNOG00000042497: 75%
Entrez Gene ID: 101929726
Uniprot ID: A0A1B0GTQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLG
Gene Sequence ARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLG
Gene ID - Mouse ENSMUSG00000079471
Gene ID - Rat ENSRNOG00000042497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYMX pAb (ATL-HPA051451)
Datasheet Anti MYMX pAb (ATL-HPA051451) Datasheet (External Link)
Vendor Page Anti MYMX pAb (ATL-HPA051451) at Atlas Antibodies

Documents & Links for Anti MYMX pAb (ATL-HPA051451)
Datasheet Anti MYMX pAb (ATL-HPA051451) Datasheet (External Link)
Vendor Page Anti MYMX pAb (ATL-HPA051451)