Anti MYLK2 pAb (ATL-HPA059704 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059704-25

• 
• 
• 

Protein Description: myosin light chain kinase 2
Gene Name: MYLK2
Alternative Gene Name: KMLC, MLCK2, skMLCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027470: 91%, ENSRNOG00000008235: 89%
Entrez Gene ID: 85366
Uniprot ID: Q9H1R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCTCMEKAT
• Gene Sequence: IEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCTCMEKAT
• Gene ID - Mouse: ENSMUSG00000027470
• Gene ID - Rat: ENSRNOG00000008235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.