![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm & mitotic spindle.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104391/184513/atl-hpa065102_anti-myf6-atl-hpa065102_67973__55196.1710522910.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm & mitotic spindle.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm & mitotic spindle.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104391/184513/atl-hpa065102_anti-myf6-atl-hpa065102_67973__55196.1710522910.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm & mitotic spindle.")
Polyclonal Antibody against Human MYF6, Gene description: myogenic factor 6, Alternative Gene Names: bHLHc4, MRF4, Validated applications: ICC, Uniprot ID: P23409, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAP |
| Documents & Links for Anti-MYF6 pAb (ATL-HPA065102) | |
| Vendor Page | Anti-MYF6 pAb (ATL-HPA065102) at Atlas |
| Documents & Links for Anti-MYF6 pAb (ATL-HPA065102) | |
| Vendor Page | Anti-MYF6 pAb (ATL-HPA065102) |