Anti MYC pAb (ATL-HPA066556)

Atlas Antibodies

SKU: ATL-HPA066556-25

• 

Protein Description: v-myc avian myelocytomatosis viral oncogene homolog
Gene Name: MYC
Alternative Gene Name: bHLHe39, c-Myc, MYCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022346: 87%, ENSRNOG00000004500: 87%
Entrez Gene ID: 4609
Uniprot ID: P01106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
• Gene Sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
• Gene ID - Mouse: ENSMUSG00000022346
• Gene ID - Rat: ENSRNOG00000004500
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.