Protein Description: v-myc avian myelocytomatosis viral oncogene homolog
Gene Name: MYC
Alternative Gene Name: bHLHe39, c-Myc, MYCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022346: 87%, ENSRNOG00000004500: 87%
Entrez Gene ID: 4609
Uniprot ID: P01106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYC
Alternative Gene Name: bHLHe39, c-Myc, MYCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022346: 87%, ENSRNOG00000004500: 87%
Entrez Gene ID: 4609
Uniprot ID: P01106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP |
| Documents & Links for Anti MYC pAb (ATL-HPA066556) | |
| Datasheet | Anti MYC pAb (ATL-HPA066556) Datasheet (External Link) |
| Vendor Page | Anti MYC pAb (ATL-HPA066556) at Atlas |
| Documents & Links for Anti MYC pAb (ATL-HPA066556) | |
| Datasheet | Anti MYC pAb (ATL-HPA066556) Datasheet (External Link) |
| Vendor Page | Anti MYC pAb (ATL-HPA066556) |