Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046745-25

• 

Protein Description: myosin binding protein C, fast type
Gene Name: MYBPC2
Alternative Gene Name: MGC163408, MYBPC, MYBPCF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038670: 95%, ENSRNOG00000019627: 95%
Entrez Gene ID: 4606
Uniprot ID: Q14324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV
• Gene Sequence: RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV
• Gene ID - Mouse: ENSMUSG00000038670
• Gene ID - Rat: ENSRNOG00000019627
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.