Anti MX1 pAb (ATL-HPA049724)

Atlas Antibodies

SKU: ATL-HPA049724-25

• 
• 

Protein Description: MX dynamin-like GTPase 1
Gene Name: MX1
Alternative Gene Name: IFI-78K, MxA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000386: 55%, ENSRNOG00000001963: 72%
Entrez Gene ID: 4599
Uniprot ID: P20591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
• Gene Sequence: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
• Gene ID - Mouse: ENSMUSG00000000386
• Gene ID - Rat: ENSRNOG00000001963
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.