Anti MVB12B pAb (ATL-HPA049383)

Atlas Antibodies

SKU: ATL-HPA049383-25

• 

Protein Description: multivesicular body subunit 12B
Gene Name: MVB12B
Alternative Gene Name: C9orf28, FAM125B, FLJ00001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038740: 97%, ENSRNOG00000017172: 97%
Entrez Gene ID: 89853
Uniprot ID: Q9H7P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRM
• Gene Sequence: KLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRM
• Gene ID - Mouse: ENSMUSG00000038740
• Gene ID - Rat: ENSRNOG00000017172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.