Protein Description: metastasis suppressor 1
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 93%, ENSRNOG00000009001: 93%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 93%, ENSRNOG00000009001: 93%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMF |
| Documents & Links for Anti MTSS1 pAb (ATL-HPA075540) | |
| Datasheet | Anti MTSS1 pAb (ATL-HPA075540) Datasheet (External Link) |
| Vendor Page | Anti MTSS1 pAb (ATL-HPA075540) at Atlas |
| Documents & Links for Anti MTSS1 pAb (ATL-HPA075540) | |
| Datasheet | Anti MTSS1 pAb (ATL-HPA075540) Datasheet (External Link) |
| Vendor Page | Anti MTSS1 pAb (ATL-HPA075540) |