Anti MTR pAb (ATL-HPA054915)

Atlas Antibodies

SKU:
ATL-HPA054915-25
  • Immunohistochemical staining of human fallopian tube shows strong positivity in cilia in a subset of glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: 5-methyltetrahydrofolate-homocysteine methyltransferase
Gene Name: MTR
Alternative Gene Name: cblG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021311: 96%, ENSRNOG00000017593: 97%
Entrez Gene ID: 4548
Uniprot ID: Q99707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLI
Gene Sequence DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLI
Gene ID - Mouse ENSMUSG00000021311
Gene ID - Rat ENSRNOG00000017593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MTR pAb (ATL-HPA054915)
Datasheet Anti MTR pAb (ATL-HPA054915) Datasheet (External Link)
Vendor Page Anti MTR pAb (ATL-HPA054915) at Atlas Antibodies

Documents & Links for Anti MTR pAb (ATL-HPA054915)
Datasheet Anti MTR pAb (ATL-HPA054915) Datasheet (External Link)
Vendor Page Anti MTR pAb (ATL-HPA054915)