Protein Description: methylenetetrahydrofolate reductase (NAD(P)H)
Gene Name: MTHFR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029009: 94%, ENSRNOG00000008553: 93%
Entrez Gene ID: 4524
Uniprot ID: P42898
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTHFR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029009: 94%, ENSRNOG00000008553: 93%
Entrez Gene ID: 4524
Uniprot ID: P42898
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPA |
Documents & Links for Anti MTHFR pAb (ATL-HPA063389) | |
Datasheet | Anti MTHFR pAb (ATL-HPA063389) Datasheet (External Link) |
Vendor Page | Anti MTHFR pAb (ATL-HPA063389) at Atlas |
Documents & Links for Anti MTHFR pAb (ATL-HPA063389) | |
Datasheet | Anti MTHFR pAb (ATL-HPA063389) Datasheet (External Link) |
Vendor Page | Anti MTHFR pAb (ATL-HPA063389) |