Protein Description: mitochondrial fission process 1
Gene Name: MTFP1
Alternative Gene Name: HSPC242, MTP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001870: 35%, ENSRNOG00000054624: 35%
Entrez Gene ID: 51537
Uniprot ID: Q9UDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTFP1
Alternative Gene Name: HSPC242, MTP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001870: 35%, ENSRNOG00000054624: 35%
Entrez Gene ID: 51537
Uniprot ID: Q9UDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA |
Gene ID - Mouse | ENSMUSG00000001870 |
Gene ID - Rat | ENSMUSG00000001870 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTFP1 pAb (ATL-HPA077396) | |
Datasheet | Anti MTFP1 pAb (ATL-HPA077396) Datasheet (External Link) |
Vendor Page | Anti MTFP1 pAb (ATL-HPA077396) at Atlas |
Documents & Links for Anti MTFP1 pAb (ATL-HPA077396) | |
Datasheet | Anti MTFP1 pAb (ATL-HPA077396) Datasheet (External Link) |
Vendor Page | Anti MTFP1 pAb (ATL-HPA077396) |