Anti MTFP1 pAb (ATL-HPA077396)

Catalog No:
ATL-HPA077396-25
$447.00
Protein Description: mitochondrial fission process 1
Gene Name: MTFP1
Alternative Gene Name: HSPC242, MTP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001870: 35%, ENSRNOG00000054624: 35%
Entrez Gene ID: 51537
Uniprot ID: Q9UDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
Gene ID - Mouse ENSMUSG00000001870
Gene ID - Rat ENSMUSG00000001870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MTFP1 pAb (ATL-HPA077396)
Datasheet Anti MTFP1 pAb (ATL-HPA077396) Datasheet (External Link)
Vendor Page Anti MTFP1 pAb (ATL-HPA077396) at Atlas

Documents & Links for Anti MTFP1 pAb (ATL-HPA077396)
Datasheet Anti MTFP1 pAb (ATL-HPA077396) Datasheet (External Link)
Vendor Page Anti MTFP1 pAb (ATL-HPA077396)