Anti MTCL1 pAb (ATL-HPA046245)

Atlas Antibodies

SKU:
ATL-HPA046245-25
  • Immunohistochemical staining of human esophagus shows strong nuclear, cytoplasmic and membranous positivity in superficial layer of squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: microtubule crosslinking factor 1
Gene Name: MTCL1
Alternative Gene Name: CCDC165, KIAA0802, SOGA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052105: 78%, ENSRNOG00000025527: 80%
Entrez Gene ID: 23255
Uniprot ID: Q9Y4B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRGCGFPVGEHSPHSRVQIGDHSLRLQTADRGQPHKQVVENQQLFSAFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLKCRLEQ
Gene Sequence DRGCGFPVGEHSPHSRVQIGDHSLRLQTADRGQPHKQVVENQQLFSAFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLKCRLEQ
Gene ID - Mouse ENSMUSG00000052105
Gene ID - Rat ENSRNOG00000025527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MTCL1 pAb (ATL-HPA046245)
Datasheet Anti MTCL1 pAb (ATL-HPA046245) Datasheet (External Link)
Vendor Page Anti MTCL1 pAb (ATL-HPA046245) at Atlas Antibodies

Documents & Links for Anti MTCL1 pAb (ATL-HPA046245)
Datasheet Anti MTCL1 pAb (ATL-HPA046245) Datasheet (External Link)
Vendor Page Anti MTCL1 pAb (ATL-HPA046245)