Anti MTAP pAb (ATL-HPA046915)

Atlas Antibodies

SKU:
ATL-HPA046915-100
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: methylthioadenosine phosphorylase
Gene Name: MTAP
Alternative Gene Name: c86fus, MSAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062937: 89%, ENSRNOG00000006615: 89%
Entrez Gene ID: 4507
Uniprot ID: Q13126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR
Gene Sequence IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR
Gene ID - Mouse ENSMUSG00000062937
Gene ID - Rat ENSRNOG00000006615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MTAP pAb (ATL-HPA046915)
Datasheet Anti MTAP pAb (ATL-HPA046915) Datasheet (External Link)
Vendor Page Anti MTAP pAb (ATL-HPA046915) at Atlas Antibodies

Documents & Links for Anti MTAP pAb (ATL-HPA046915)
Datasheet Anti MTAP pAb (ATL-HPA046915) Datasheet (External Link)
Vendor Page Anti MTAP pAb (ATL-HPA046915)